| UniProt ID | VIP_HUMAN | |
|---|---|---|
| UniProt AC | P01282 | |
| Protein Name | VIP peptides | |
| Gene Name | VIP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 170 | |
| Subcellular Localization | Secreted. | |
| Protein Description | VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; PHM and PHV also cause vasodilation. PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin.. | |
| Protein Sequence | MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | Phosphorylation | QTSAWPLYRAPSALR CCCCCHHHCCCCHHC | 10.72 | 22817900 | |
| 76 | Phosphorylation | DTPYYDVSRNARHAD CCCCCCCCCCHHCCC | 19.54 | - | |
| 98 | Phosphorylation | SKLLGQLSAKKYLES HHHHHHHHHHHHHHH | 30.10 | 27499020 | |
| 100 | Acetylation | LLGQLSAKKYLESLM HHHHHHHHHHHHHHC | 38.28 | 25953088 | |
| 105 | Phosphorylation | SAKKYLESLMGKRVS HHHHHHHHHCCCCHH | 22.51 | - | |
| 107 | Methionine amide | KKYLESLMGKRVSSN HHHHHHHCCCCHHCC | 9.17 | - | |
| 107 | Amidation | KKYLESLMGKRVSSN HHHHHHHCCCCHHCC | 9.17 | 3748844 | |
| 107 | Methylation | KKYLESLMGKRVSSN HHHHHHHCCCCHHCC | 9.17 | 3748844 | |
| 112 | Phosphorylation | SLMGKRVSSNISEDP HHCCCCHHCCCCCCC | 23.00 | 24850871 | |
| 113 | Phosphorylation | LMGKRVSSNISEDPV HCCCCHHCCCCCCCC | 35.01 | 24850871 | |
| 116 | Phosphorylation | KRVSSNISEDPVPVK CCHHCCCCCCCCCCC | 39.95 | 24850871 | |
| 152 | Asparagine amide | KYLNSILNGKRSSEG HHHHHHHCCCCCCCC | 52.88 | - | |
| 152 | Amidation | KYLNSILNGKRSSEG HHHHHHHCCCCCCCC | 52.88 | 3748844 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VIP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VIP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VIP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ACTBL_HUMAN | ACTBL2 | physical | 28514442 | |
| PXDN_HUMAN | PXDN | physical | 28514442 | |
| 2ABD_HUMAN | PPP2R2D | physical | 28514442 | |
| LRP2_HUMAN | LRP2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
