| UniProt ID | VIAF1_DROME | |
|---|---|---|
| UniProt AC | Q8MR62 | |
| Protein Name | Viral IAP-associated factor homolog | |
| Gene Name | viaf | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 240 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Modulates the activation of caspases during apoptosis.. | |
| Protein Sequence | MQDPNEDTEWNDVLRAKGIIGPKAKEAEITEDQIQKLMDDAIQRRTDLPLNEGQRDKKIDDMSLDELDELEDSEDEAVLEQYRQRRIAEMRATAEKARFGSVREISGQDYVNEVTKAGEGIWVVLHLYANGVPLCALIHHHMQQLAVRFPQTKFVRSVATTCIPNFPEKNLPTIFIYHEGALRKQYIGPLELRGDKLTAEELEFMLGQAGAVPTEITEDPRPQIRDKMLADLEDKSSDFY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | DDAIQRRTDLPLNEG HHHHHHHCCCCCCCC | 44.04 | 21082442 | |
| 63 | Phosphorylation | DKKIDDMSLDELDEL CCCCCCCCHHHHHHC | 39.40 | 22817900 | |
| 73 | Phosphorylation | ELDELEDSEDEAVLE HHHHCCCCCCHHHHH | 37.26 | 19429919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VIAF1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VIAF1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VIAF1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FEN1_DROME | Fen1 | physical | 25242320 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-63 AND SER-73, AND MASSSPECTROMETRY. | |