dbPTM

VIAF1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VIAF1_DROME
UniProt AC	Q8MR62
Protein Name	Viral IAP-associated factor homolog
Gene Name	viaf
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	240
Subcellular Localization	Cytoplasm.
Protein Description	Modulates the activation of caspases during apoptosis..
Protein Sequence	MQDPNEDTEWNDVLRAKGIIGPKAKEAEITEDQIQKLMDDAIQRRTDLPLNEGQRDKKIDDMSLDELDELEDSEDEAVLEQYRQRRIAEMRATAEKARFGSVREISGQDYVNEVTKAGEGIWVVLHLYANGVPLCALIHHHMQQLAVRFPQTKFVRSVATTCIPNFPEKNLPTIFIYHEGALRKQYIGPLELRGDKLTAEELEFMLGQAGAVPTEITEDPRPQIRDKMLADLEDKSSDFY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	Phosphorylation	DDAIQRRTDLPLNEG HHHHHHHCCCCCCCC	44.04	21082442
63	Phosphorylation	DKKIDDMSLDELDEL CCCCCCCCHHHHHHC	39.40	22817900
73	Phosphorylation	ELDELEDSEDEAVLE HHHHCCCCCCHHHHH	37.26	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VIAF1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VIAF1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VIAF1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
FEN1_DROME	Fen1	physical	25242320

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VIAF1_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-63 AND SER-73, AND MASSSPECTROMETRY.	18327897 [Abstract]