VE7_HPV16 - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VE7_HPV16
• UniProt AC: P03129
• Protein Name: Protein E7 {ECO:0000255|HAMAP-Rule:MF_04004}
• Gene Name: E7 {ECO:0000255|HAMAP-Rule:MF_04004}
• Organism: Human papillomavirus type 16.
• Sequence Length: 98
• Subcellular Localization: Host cytoplasm . Host nucleus . Predominantly found in the host nucleus.
• Protein Description: Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta)..
• Protein Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	CYEQLNDSSEEEDEI EEECCCCCCCCCCCC	38.28	1956339
32	Phosphorylation	YEQLNDSSEEEDEID EECCCCCCCCCCCCC	52.47	1956339

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
31	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
31	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
32	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
32	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
-	K	Ubiquitination	E3 ubiquitin ligase	SKP2	Q13309	PMID:15113913

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VE7_HPV16 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VE7_HPV16 !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RB_HUMAN	RB1	physical	1331501
CCNA2_HUMAN	CCNA2	physical	1331501
RBL2_HUMAN	RBL2	physical	1331501
RBL1_HUMAN	RBL1	physical	1331501
CBP_HUMAN	CREBBP	physical	25451029
RB_HUMAN	RB1	physical	25451029
KAT2B_HUMAN	KAT2B	physical	12163591
RB_HUMAN	RB1	physical	10891495

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.