UniProt ID | VAV3_MOUSE | |
---|---|---|
UniProt AC | Q9R0C8 | |
Protein Name | Guanine nucleotide exchange factor VAV3 | |
Gene Name | Vav3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 847 | |
Subcellular Localization | ||
Protein Description | Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases (By similarity). Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3-mediated adhesion. Does not affect integrin beta-1-mediated adhesion.. | |
Protein Sequence | MEPWKQCAQWLIHSKVLPPNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRPHSINLKEINLRPQMSQFLCLKNIRTFLAACCDTFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETRVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAQQPKSQENDIRSCCLAEIRQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPDLVKVHRSLMQEIHDSIVNKDDQNLYQVFINYKERLVIYGQYCSGVESAISNLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDPMEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCRVCQMLLRGTFYQGYLCFKCGAKAHKECLGRVDNCGRVNSVEQGPFKPPEKRTNGLRRASRQVDPGLPKMQVIRNYTGTPAPGLHEGPPLHIQAGDTVELLRGDAHSVFWQGRNLASGEVGFFPSDAVKPSPCVPKPVDYSCQPWYAGPMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEQPAGQRGNRTGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
141 | Phosphorylation | SINDEDIYKGLPDLI CCCHHHHHCCCHHHC | 16.01 | 22817900 | |
173 | Phosphorylation | EDEGGEVYEDLMKAE CCCCCHHHHHHHHHH | 10.22 | 22817900 | |
187 | Phosphorylation | EEAQQPKSQENDIRS HHHHCCCCCCCCHHH | 49.78 | 30387612 | |
317 | Acetylation | SKRANNGKFTLRDLL HHHCCCCCCCHHHHH | 36.98 | 7970555 | |
692 | Phosphorylation | ELINRVNSTYLVRHR HHHHHHCCEEEEEEE | 18.64 | 29176673 | |
693 | Phosphorylation | LINRVNSTYLVRHRT HHHHHCCEEEEEEEE | 18.70 | 29176673 | |
717 | Acetylation | IKYNNEAKHIKILTR EEECCCCCEEEEEEC | 39.42 | 15608305 | |
720 | Acetylation | NNEAKHIKILTRDGF CCCCCEEEEEECCCC | 31.23 | 15608315 | |
738 | Phosphorylation | AENRKFKSLMELVEY HHCCHHHHHHHHHHH | 35.76 | - | |
750 | Phosphorylation | VEYYKHHSLKEGFRT HHHHHHCCHHHCCCC | 40.64 | - | |
783 | Phosphorylation | RGNRTGNSLLSPKVL CCCCCCCCCCCHHHH | 31.84 | 29176673 | |
786 | Phosphorylation | RTGNSLLSPKVLGIA CCCCCCCCHHHHEEE | 28.15 | 24453211 | |
797 | Phosphorylation | LGIAIARYDFCARDM HEEEHHHCHHHHCCH | 12.35 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAV3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAV3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAV3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRAF6_MOUSE | Traf6 | physical | 27507811 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...