UniProt ID | VATG2_HUMAN | |
---|---|---|
UniProt AC | O95670 | |
Protein Name | V-type proton ATPase subunit G 2 | |
Gene Name | ATP6V1G2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 118 | |
Subcellular Localization | Melanosome . Highly enriched in late-stage melanosomes. | |
Protein Description | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
Protein Sequence | MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MASQSQGIQQ -----CCHHHHHHHH | 29.12 | 25159151 | |
5 | Phosphorylation | ---MASQSQGIQQLL ---CCHHHHHHHHHH | 28.07 | 29507054 | |
16 | Ubiquitination | QQLLQAEKRAAEKVA HHHHHHHHHHHHHHH | 50.80 | - | |
16 | 2-Hydroxyisobutyrylation | QQLLQAEKRAAEKVA HHHHHHHHHHHHHHH | 50.80 | - | |
47 | Phosphorylation | AQMEVEQYRREREHE HHHHHHHHHHHHHHH | 9.72 | - | |
57 | Phosphorylation | EREHEFQSKQQAAMG HHHHHHHHHHHHHHC | 37.44 | 24719451 | |
65 | Phosphorylation | KQQAAMGSQGNLSAE HHHHHHCCCCCHHHH | 23.10 | 21406692 | |
70 | Phosphorylation | MGSQGNLSAEVEQAT HCCCCCHHHHHHHHH | 26.78 | 24719451 | |
77 | Phosphorylation | SAEVEQATRRQVQGM HHHHHHHHHHHHHHH | 26.53 | 21406692 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATG2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATG2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATG2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VATE1_HUMAN | ATP6V1E1 | physical | 14667819 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...