dbPTM

URM1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	URM1_DROME
UniProt AC	Q7KU86
Protein Name	Ubiquitin-related modifier 1 homolog {ECO:0000255\|HAMAP-Rule:MF_03048}
Gene Name	CG33276
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	101
Subcellular Localization	Cytoplasm .
Protein Description	Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates..
Protein Sequence	MGTPELKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTERPELFLQGDTVRPGILVLINDTDWELLGELDYELQPNDNVLFISTLHGG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
101	1-thioglycine	FISTLHGG------- EEEECCCC-------	24.49	-
101	Thiocarboxylation	FISTLHGG------- EEEECCCC-------	24.49	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of URM1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of URM1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of URM1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MOCS3_DROME	CG13090	genetic	26715182
PRDX1_DROME	Jafrac1	genetic	26715182
MOCS3_DROME	CG13090	physical	26715182

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of URM1_DROME

Related Literatures of Post-Translational Modification