dbPTM

UPP3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UPP3_SCHPO
UniProt AC	Q9US43
Protein Name	Putative uracil phosphoribosyltransferase urg2
Gene Name	urg2 {ECO:0000312\|PomBase:SPAC1002.17c}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	204
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate..
Protein Sequence	MSTTTTVSAIRTVEEMSNITISSHPVVNEQIAILRDRSLKPSQVRSVVDEISRFLAYESTKTLKSPSVSIVPVLRSGMSMMSAFSKVLPDVPIYHIGIFREKSTLQPIEYYNKLPKKSTDTAVILDPVMATGGTANAVITTLQEWGCKNIIFVSVLASEQALTRFSNIPGVEFVIGAVDKSLDAKGYLVPGVGDIGDRLYGATA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
65	Phosphorylation	ESTKTLKSPSVSIVP HCCCCCCCCCCCHHH	26.06	25720772
69	Phosphorylation	TLKSPSVSIVPVLRS CCCCCCCCHHHHHHC	23.39	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UPP3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UPP3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UPP3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UPP3_SCHPO	urg2	physical	23695164
UPP3_SCHPO	urg2	physical	26771498
TFS2_SCHPO	tfs1	physical	26771498
YF75_SCHPO	spa2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UPP3_SCHPO

Related Literatures of Post-Translational Modification