UN119_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UN119_CAEEL
• UniProt AC: Q10658
• Protein Name: Protein unc-119
• Gene Name: unc-119
• Organism: Caenorhabditis elegans.
• Sequence Length: 219
• Protein Description: Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Plays a key role in ciliary membrane localization of proteins. Required for the establishment or function of the nervous system..
• Protein Sequence: MKAEQQQQSIAPGSATFPSQMPRPPPVTEQAITTEAELLAKNQITPNDVLALPGITQGFLCSPSANVYNIEFTKFQIRDLDTEHVLFEIAKPENETEENLQAQAESARYVRYRFAPNFLKLKTVGATVEFKVGDVPITHFRMIERHFFKDRLLKCFDFEFGFCMPNSRNNCEHIYEFPQLSQQLMDDMINNPNETRSDSFYFVENKLVMHNKADYSYDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UN119_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UN119_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UN119_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UN119_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARL3_CAEEL	arl-3	physical	14704431
ARL3_CAEEL	arl-3	physical	16725058

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.