UniProt ID | UN119_CAEEL | |
---|---|---|
UniProt AC | Q10658 | |
Protein Name | Protein unc-119 | |
Gene Name | unc-119 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 219 | |
Subcellular Localization | ||
Protein Description | Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Plays a key role in ciliary membrane localization of proteins. Required for the establishment or function of the nervous system.. | |
Protein Sequence | MKAEQQQQSIAPGSATFPSQMPRPPPVTEQAITTEAELLAKNQITPNDVLALPGITQGFLCSPSANVYNIEFTKFQIRDLDTEHVLFEIAKPENETEENLQAQAESARYVRYRFAPNFLKLKTVGATVEFKVGDVPITHFRMIERHFFKDRLLKCFDFEFGFCMPNSRNNCEHIYEFPQLSQQLMDDMINNPNETRSDSFYFVENKLVMHNKADYSYDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UN119_CAEEL !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UN119_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UN119_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UN119_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARL3_CAEEL | arl-3 | physical | 14704431 | |
ARL3_CAEEL | arl-3 | physical | 16725058 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...