UniProt ID | ARL3_CAEEL | |
---|---|---|
UniProt AC | O45379 | |
Protein Name | ADP-ribosylation factor-like protein 3 | |
Gene Name | arl-3 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 184 | |
Subcellular Localization | Golgi apparatus. | |
Protein Description | GTP-binding protein that may be involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
Protein Sequence | MGLIDVLKSFKSPSGREIRILLLGLDNAGKTTILKQLSSEDVQHVTPTKGFNVKTVAAMGDIRLNVWDIGGQRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIELGELLDEEKLRKVPVLIFANKQDLVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWVASNLKPASKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGLIDVLKS ------CCHHHHHHH | 31.19 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL3_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL3_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL3_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARL3_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...