UniProt ID | UL56_HHV2H | |
---|---|---|
UniProt AC | P28282 | |
Protein Name | Protein UL56 | |
Gene Name | UL56 | |
Organism | Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2). | |
Sequence Length | 235 | |
Subcellular Localization |
Host membrane Single-pass membrane protein . Host cytoplasm . If expressed alone, is predominantly present in host trans-Golgi network (TGN) and partially in Golgi complex and early endosomes. |
|
Protein Description | Plays a role in the transport and release of virions form the host cytoplasm to the extracellular space. Relocalizes host NEDD4, a cytosolic E3 ligase, to cytoplasmic vesicles.. | |
Protein Sequence | MALGAGHAHACRDDGDDSVIDAPPPYESVAGASAGQFVVIDIDTPTDSPPPYSAGTSPVGLVSPASSGDGEVCERGRSRRAAWRAARRARRRAERRARRRSFGPGGLFVETPLFLPETMIGAHPGVGGDLPSGLPTYAEATSDRPPTYAMVMAACPTEPPGGSVGPADQPRVQSSRTWRPPLVNSRELYRAQRAARCASSSDTPQAPGWCGGTCRHAVFGVVAVVVVIILAFLWR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UL56_HHV2H !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UL56_HHV2H !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UL56_HHV2H !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UL56_HHV2H !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NEDD4_HUMAN | NEDD4 | physical | 18353951 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...