UL56_HHV2H - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UL56_HHV2H
• UniProt AC: P28282
• Protein Name: Protein UL56
• Gene Name: UL56
• Organism: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2).
• Sequence Length: 235
• Subcellular Localization: Host membrane ; Single-pass membrane protein . Host cytoplasm . If expressed alone, is predominantly present in host trans-Golgi network (TGN) and partially in Golgi complex and early endosomes.
• Protein Description: Plays a role in the transport and release of virions form the host cytoplasm to the extracellular space. Relocalizes host NEDD4, a cytosolic E3 ligase, to cytoplasmic vesicles..
• Protein Sequence: MALGAGHAHACRDDGDDSVIDAPPPYESVAGASAGQFVVIDIDTPTDSPPPYSAGTSPVGLVSPASSGDGEVCERGRSRRAAWRAARRARRRAERRARRRSFGPGGLFVETPLFLPETMIGAHPGVGGDLPSGLPTYAEATSDRPPTYAMVMAACPTEPPGGSVGPADQPRVQSSRTWRPPLVNSRELYRAQRAARCASSSDTPQAPGWCGGTCRHAVFGVVAVVVVIILAFLWR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UL56_HHV2H !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UL56_HHV2H !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UL56_HHV2H !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UL56_HHV2H !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NEDD4_HUMAN	NEDD4	physical	18353951

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.