dbPTM

UL21A_HCMVM - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UL21A_HCMVM
UniProt AC	F5HH39
Protein Name	Uncharacterized protein UL21A
Gene Name	UL21A
Organism	Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5).
Sequence Length	123
Subcellular Localization	Host cytoplasm.
Protein Description	Required for efficient viral DNA synthesis and the late accumulation of viral IE transcripts..
Protein Sequence	MGGSPVPQLTTVTQGLMPSVRMDFRARRPLRRLAFYAPRARRRLFQNHIHPEQRRVLVGEGDEEMLPDLPMEIDIVIDRPPQQPLPNPLVLLLDDVPPHVPGFAPYRVPRPHPMIPEEHWDQF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of UL21A_HCMVM !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UL21A_HCMVM !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UL21A_HCMVM !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UL21A_HCMVM !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC27_HUMAN	CDC27	physical	22792066
APC7_HUMAN	ANAPC7	physical	22792066
CDC23_HUMAN	CDC23	physical	22792066

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UL21A_HCMVM

Related Literatures of Post-Translational Modification