UniProt ID | UL21A_HCMVA | |
---|---|---|
UniProt AC | Q7M6R1 | |
Protein Name | Uncharacterized protein UL21A | |
Gene Name | UL21A | |
Organism | Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). | |
Sequence Length | 123 | |
Subcellular Localization | Host cytoplasm . | |
Protein Description | Required for efficient viral DNA synthesis and the late accumulation of viral IE transcripts.. | |
Protein Sequence | MGGSPVPQLTTVTQGLMPSVRMDFRARRPLRRLAFYAPRARRRLFQNHIHPEQRRVLVGEGDEEMLPDLPMEIDIVIDRPPQQPLPNPLVLLLDDVPPHVPGFAPYRVPRPHPMIPEEHWDQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UL21A_HCMVA !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UL21A_HCMVA !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UL21A_HCMVA !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UL21A_HCMVA !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC27_HUMAN | CDC27 | physical | 22792066 | |
APC7_HUMAN | ANAPC7 | physical | 22792066 | |
CDC23_HUMAN | CDC23 | physical | 22792066 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...