dbPTM

UEV1D_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UEV1D_ARATH
UniProt AC	Q9SVD7
Protein Name	Ubiquitin-conjugating enzyme E2 variant 1D
Gene Name	UEV1D
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	146
Subcellular Localization
Protein Description	Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. Involved in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage..
Protein Sequence	MTLGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKKFGLLANWQREYTMEDILVQLKKEMSTSHNRKLVQPPEGTCF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTLGSGGSS ------CCCCCCCCE	39.56	30291188
5	Phosphorylation	---MTLGSGGSSVVV ---CCCCCCCCEEEE	42.99	30291188
8	Phosphorylation	MTLGSGGSSVVVPRN CCCCCCCCEEEECCC	24.39	19376835
9	Phosphorylation	TLGSGGSSVVVPRNF CCCCCCCEEEECCCH	23.39	19376835
116	Phosphorylation	LANWQREYTMEDILV CCCCCCEECHHHHHH	17.36	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UEV1D_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UEV1D_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UEV1D_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBC35_ARATH	UBC35	physical	18178771
SINL7_ARATH	AT5G37890	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UEV1D_ARATH

Related Literatures of Post-Translational Modification