UEV1A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UEV1A_ARATH
• UniProt AC: Q93YP0
• Protein Name: Ubiquitin-conjugating enzyme E2 variant 1A
• Gene Name: UEV1A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 158
• Protein Description: Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. Probably not involved in the error-free DNA repair..
• Protein Sequence: MSSEEAKVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMQSWTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPETGVVEPSLFPMLTNWRREYTMEDILVKLKKEMMTSHNRKLAQPPEGNEEARADPKGPAKCCVM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UEV1A_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UEV1A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UEV1A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UEV1A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC35_ARATH	UBC35	physical	18178771

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.