UCP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UCP1_HUMAN
• UniProt AC: P25874
• Protein Name: Mitochondrial brown fat uncoupling protein 1 {ECO:0000305}
• Gene Name: UCP1 {ECO:0000312|HGNC:HGNC:12517}
• Organism: Homo sapiens (Human).
• Sequence Length: 307
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates to non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. [PubMed: 24196960 However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria (By similarity]
• Protein Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	QGECPTSSVIRYKGV ECCCCCCCEEEEEEE	24.84	-
55	Phosphorylation	PTSSVIRYKGVLGTI CCCCEEEEEEEEEEE	10.85	22817900
61	Phosphorylation	RYKGVLGTITAVVKT EEEEEEEEEEEEEEE	15.82	-
88	Phosphorylation	GLQRQISSASLRIGL HHHHHHHHHCHHHCC	24.41	24905233
90	Phosphorylation	QRQISSASLRIGLYD HHHHHHHCHHHCCHH	21.82	24905233
104	Phosphorylation	DTVQEFLTAGKETAP HHHHHHHHCCCCCCC	38.39	24505115
145	Phosphorylation	KVRLQAQSHLHGIKP EEEEHHHHHHCCCCC	30.91	25072903
154	Phosphorylation	LHGIKPRYTGTYNAY HCCCCCCCCCCEEEE	20.32	23663014
155	Phosphorylation	HGIKPRYTGTYNAYR CCCCCCCCCCEEEEE	25.07	23663014
157	Phosphorylation	IKPRYTGTYNAYRII CCCCCCCCEEEEEEE	13.05	23663014
158	Phosphorylation	KPRYTGTYNAYRIIA CCCCCCCEEEEEEEE	10.11	23663014
161	Phosphorylation	YTGTYNAYRIIATTE CCCCEEEEEEEEECC	9.94	23663014
166	Phosphorylation	NAYRIIATTEGLTGL EEEEEEEECCCCCCC	18.25	23663014
167	Phosphorylation	AYRIIATTEGLTGLW EEEEEEECCCCCCCC	21.02	23663014
171	Phosphorylation	IATTEGLTGLWKGTT EEECCCCCCCCCCCC	40.88	23663014
248	Phosphorylation	INSPPGQYKSVPNCA CCCCCCCCCCCCCEE	15.90	27642862
250	Phosphorylation	SPPGQYKSVPNCAMK CCCCCCCCCCCEEEE	37.56	22817900
254	Cysteine sulfenic acid (-SOH)	QYKSVPNCAMKVFTN CCCCCCCEEEEECCC	2.99	-
254	Oxidation	QYKSVPNCAMKVFTN CCCCCCCEEEEECCC	2.99	-
260	Phosphorylation	NCAMKVFTNEGPTAF CEEEEECCCCCCCHH	35.03	22817900
265	Phosphorylation	VFTNEGPTAFFKGLV ECCCCCCCHHHHCHH	47.13	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UCP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UCP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UCP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSTM1_HUMAN	GSTM1	physical	26186194

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.