UniProt ID | UBX2A_MOUSE | |
---|---|---|
UniProt AC | Q99KJ0 | |
Protein Name | UBX domain-containing protein 2A | |
Gene Name | Ubxn2a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 258 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDCEYFVDSLFEEAGKAGAKCLSPTEQKKQVDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELWGIFDKEEVDVKVEDKKNEVCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSVEVDNKSTLSAVSLNNLEPITRIQIWLANGERTVQRFNVSHRVSHIKDFIEKYQGSQRSPPFALATALPFLRFLDETLTLEEADLKNAVIIQRLQKTAEPFRKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Ubiquitination | SLFEEAGKAGAKCLS HHHHHHHHHCCCCCC | 51.17 | - | |
93 | Phosphorylation | ASQQFLNSIKKGELP HHHHHHHHHHCCCCC | 37.62 | 26745281 | |
143 | Phosphorylation | GQGHRLGSATPRIVS CCCCCCCCCCCHHHH | 33.29 | 26824392 | |
145 | Phosphorylation | GHRLGSATPRIVSKA CCCCCCCCCHHHHCC | 18.13 | 22324799 | |
154 | Phosphorylation | RIVSKAKSVEVDNKS HHHHCCCEEEECCCC | 28.50 | 29899451 | |
240 | Acetylation | TLEEADLKNAVIIQR CCCHHHHHHHHHHHH | 43.33 | 19858705 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBX2A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBX2A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBX2A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHIP_MOUSE | Stub1 | physical | 26265139 | |
TERA_RAT | Vcp | physical | 26265139 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...