UBL3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBL3_HUMAN
• UniProt AC: O95164
• Protein Name: Ubiquitin-like protein 3
• Gene Name: UBL3
• Organism: Homo sapiens (Human).
• Sequence Length: 117
• Subcellular Localization: Cell membrane; Lipid-anchor.
• Protein Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSSNVPADM ------CCCCCCHHH	30.53	20068231
3	Phosphorylation	-----MSSNVPADMI -----CCCCCCHHHE	40.31	20068231
18	Phosphorylation	NLRLILVSGKTKEFL EEEEEEEECCCCEEE	31.00	20068231
27	Phosphorylation	KTKEFLFSPNDSASD CCCEEEECCCCCHHH	25.58	29514088
31	Phosphorylation	FLFSPNDSASDIAKH EEECCCCCHHHHHHH	35.99	29514088
33	Phosphorylation	FSPNDSASDIAKHVY ECCCCCHHHHHHHHH	33.24	29514088
84	Phosphorylation	KLPFGKTTVMHLVAR ECCCCCCHHHHHHHH	21.22	24719451
93	Phosphorylation	MHLVARETLPEPNSQ HHHHHHHCCCCCCCC	41.90	29083192
99	Phosphorylation	ETLPEPNSQGQRNRE HCCCCCCCCCCHHHH	46.53	29083192
113	S-palmitoylation	EKTGESNCCVIL--- HCCCCCCCEEEC---	2.46	16831869
114	Methylation	KTGESNCCVIL---- CCCCCCCEEEC----	2.20	-
114	Geranylgeranylation	KTGESNCCVIL---- CCCCCCCEEEC----	2.20	16831869
114	Geranylgeranylation	KTGESNCCVIL---- CCCCCCCEEEC----	2.20	16831869

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBL3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBL3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBL3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.