UniProt ID | UBIP1_MOUSE | |
---|---|---|
UniProt AC | Q811S7 | |
Protein Name | Upstream-binding protein 1 | |
Gene Name | Ubp1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 540 | |
Subcellular Localization | Nucleus. | |
Protein Description | Functions as a transcriptional activator in a promoter context-dependent manner. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2. Functions as a trans-acting factor that regulates the domestic strain CYP2D9 gene through specific association with the regulatory element SDI-A1. Binding to SDI-A1 depends on the type of nucleotide at position 299; binding is abolished by a nucleotide substitution at this position. Modulates the placental expression of CYP11A1 (By similarity).. | |
Protein Sequence | MAWVLSMDEVIESGLVHDFDSSLSGIGQELGAGAYSMSDVLALPIFKQEDSSLSLEDEAKHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPELSGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKNDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDTPTAYVNNSPSPAPTFTSSQPSTCSVPDSNSSSPNHQGDGAAQASGEQIQPSATTQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCQEQPSSTALQGQPQAAGSGGESGGGTPSVYHAIYLEEMVASEVARKLASVFNIPFHQINQVYRQGPTGIHILVSDQMVQNFQDETCFLFSTVKAENNDGIHIILK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | LVHDFDSSLSGIGQE CCCCCCCCCCCCCHH | 28.53 | - | |
51 | Phosphorylation | PIFKQEDSSLSLEDE EEECCCCCCCCCCHH | 32.21 | 21149613 | |
52 | Phosphorylation | IFKQEDSSLSLEDEA EECCCCCCCCCCHHH | 34.01 | 25521595 | |
54 | Phosphorylation | KQEDSSLSLEDEAKH CCCCCCCCCCHHHHC | 31.49 | 21149613 | |
194 | Phosphorylation | HCISTEFTPRKHGGE EEEECCCCCCCCCCC | 18.89 | - | |
293 | Acetylation | HEQKKSSKRTLPADY HHHHHCCCCCCCCCC | 57.40 | 19859179 | |
300 | Phosphorylation | KRTLPADYGDSLAKR CCCCCCCCCCHHHHC | 25.57 | 20139300 | |
306 | Acetylation | DYGDSLAKRGSCSPW CCCCHHHHCCCCCCC | 63.69 | 19859187 | |
383 | Phosphorylation | WLLKNRFSSYTRLFS HHHHCCCHHHHHHHH | 21.14 | 25338131 | |
390 | Phosphorylation | SSYTRLFSNFSGADL HHHHHHHHCCCHHHH | 41.37 | 22817900 | |
393 | Phosphorylation | TRLFSNFSGADLLKL HHHHHCCCHHHHHHC | 37.00 | 16141072 | |
425 | Phosphorylation | YNSLKSRSVRPRLTI HHHHHCCCCCCCEEE | 29.57 | 28059163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBIP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBIP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBIP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GMEB1_MOUSE | Gmeb1 | physical | 20211142 | |
ZBTB3_MOUSE | Zbtb3 | physical | 20211142 | |
GMEB2_MOUSE | Gmeb2 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...