UniProt ID | UB2V2_MOUSE | |
---|---|---|
UniProt AC | Q9D2M8 | |
Protein Name | Ubiquitin-conjugating enzyme E2 variant 2 | |
Gene Name | Ube2v2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 145 | |
Subcellular Localization | ||
Protein Description | Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.. | |
Protein Sequence | MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGSKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVILQELRRLMMSKENMKLPQPPEGQTYNN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAVSTGVKV ------CCCCCCCCC | 12.17 | - | |
66 | Acetylation | ENRIYSLKVECGSKY CCCEEEEEEECCCCC | 30.01 | 22826441 | |
66 | Ubiquitination | ENRIYSLKVECGSKY CCCEEEEEEECCCCC | 30.01 | - | |
72 | Acetylation | LKVECGSKYPEAPPS EEEECCCCCCCCCCC | 50.54 | 22826441 | |
72 | Malonylation | LKVECGSKYPEAPPS EEEECCCCCCCCCCC | 50.54 | 26320211 | |
72 | Ubiquitination | LKVECGSKYPEAPPS EEEECCCCCCCCCCC | 50.54 | - | |
85 | Ubiquitination | PSVRFVTKINMNGIN CCEEEEEEEECCCCC | 27.12 | - | |
108 | Ubiquitination | RSIPVLAKWQNSYSI CHHHHHECCCCCCHH | 45.19 | - | |
129 | Ubiquitination | LRRLMMSKENMKLPQ HHHHHCCHHHCCCCC | 34.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2V2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2V2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2V2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBE2N_MOUSE | Ube2n | physical | 12039045 | |
UBE2N_MOUSE | Ube2n | physical | 11406273 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...