| UniProt ID | UB2V1_MOUSE | |
|---|---|---|
| UniProt AC | Q9CZY3 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 variant 1 | |
| Gene Name | Ube2v1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 147 | |
| Subcellular Localization | Nucleus. Excluded from the nucleolus.. | |
| Protein Description | Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation (By similarity). Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes (By similarity).. | |
| Protein Sequence | MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPSVRFVTRVNMSGVSSSNGVVDPRATAVLAKWQNSHSIKVILQELRRLMMSKENMKLPQPPEGQCYSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAATTGSGV ------CCCCCCCCC | 17.32 | - | |
| 4 | Phosphorylation | ----MAATTGSGVKV ----CCCCCCCCCCC | 23.35 | 28066266 | |
| 5 | Phosphorylation | ---MAATTGSGVKVP ---CCCCCCCCCCCC | 25.32 | 28066266 | |
| 7 | Phosphorylation | -MAATTGSGVKVPRN -CCCCCCCCCCCCCC | 38.02 | 30352176 | |
| 10 | Malonylation | ATTGSGVKVPRNFRL CCCCCCCCCCCCCHH | 50.47 | 26320211 | |
| 68 | Ubiquitination | ENRIYSLKIECGPKY CCCEEEEEEECCCCC | 30.44 | - | |
| 68 | Acetylation | ENRIYSLKIECGPKY CCCEEEEEEECCCCC | 30.44 | 22826441 | |
| 71 | S-nitrosocysteine | IYSLKIECGPKYPEA EEEEEEECCCCCCCC | 14.93 | - | |
| 71 | S-nitrosylation | IYSLKIECGPKYPEA EEEEEEECCCCCCCC | 14.93 | 21278135 | |
| 74 | Ubiquitination | LKIECGPKYPEAPPS EEEECCCCCCCCCCC | 59.74 | - | |
| 74 | Malonylation | LKIECGPKYPEAPPS EEEECCCCCCCCCCC | 59.74 | 26320211 | |
| 74 | Acetylation | LKIECGPKYPEAPPS EEEECCCCCCCCCCC | 59.74 | 23806337 | |
| 110 | Ubiquitination | RATAVLAKWQNSHSI HHHHHHHHHCCCHHH | 45.19 | - | |
| 118 | Acetylation | WQNSHSIKVILQELR HCCCHHHHHHHHHHH | 26.66 | 22826441 | |
| 131 | Ubiquitination | LRRLMMSKENMKLPQ HHHHHCCHHHCCCCC | 34.90 | - | |
| 131 | Malonylation | LRRLMMSKENMKLPQ HHHHHCCHHHCCCCC | 34.90 | 26320211 | |
| 131 | Acetylation | LRRLMMSKENMKLPQ HHHHHCCHHHCCCCC | 34.90 | 22826441 | |
| 135 | Ubiquitination | MMSKENMKLPQPPEG HCCHHHCCCCCCCCC | 69.47 | - | |
| 144 | S-nitrosocysteine | PQPPEGQCYSN---- CCCCCCCCCCC---- | 6.22 | - | |
| 144 | S-nitrosylation | PQPPEGQCYSN---- CCCCCCCCCCC---- | 6.22 | 21278135 | |
| 145 | Phosphorylation | QPPEGQCYSN----- CCCCCCCCCC----- | 11.89 | 25619855 | |
| 146 | Phosphorylation | PPEGQCYSN------ CCCCCCCCC------ | 43.63 | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2V1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2V1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2V1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBE2N_MOUSE | Ube2n | physical | 12039045 | |
| UBE2N_MOUSE | Ube2n | physical | 11406273 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...