UB2E1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UB2E1_MOUSE
• UniProt AC: P52482
• Protein Name: Ubiquitin-conjugating enzyme E2 E1
• Gene Name: Ube2e1
• Organism: Mus musculus (Mouse).
• Sequence Length: 193
• Subcellular Localization: Nucleus .
• Protein Description: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination..
• Protein Sequence: MSDDDSRASTSSSSSSSSNQQTEKEGSTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDDDSRAS ------CCCCCCCCC	50.15	26824392
2	Acetylation	------MSDDDSRAS ------CCCCCCCCC	50.15	-
6	Phosphorylation	--MSDDDSRASTSSS --CCCCCCCCCCCCC	36.42	26160508
9	Phosphorylation	SDDDSRASTSSSSSS CCCCCCCCCCCCCCC	27.93	26160508
10	Phosphorylation	DDDSRASTSSSSSSS CCCCCCCCCCCCCCC	31.48	26160508
11	Phosphorylation	DDSRASTSSSSSSSS CCCCCCCCCCCCCCC	26.23	26160508
12	Phosphorylation	DSRASTSSSSSSSSN CCCCCCCCCCCCCCC	34.04	26160508
13	Phosphorylation	SRASTSSSSSSSSNQ CCCCCCCCCCCCCCC	33.72	26160508
14	Phosphorylation	RASTSSSSSSSSNQQ CCCCCCCCCCCCCCC	35.87	26160508
15	Phosphorylation	ASTSSSSSSSSNQQT CCCCCCCCCCCCCCC	35.87	26160508
16	Phosphorylation	STSSSSSSSSNQQTE CCCCCCCCCCCCCCC	39.47	26160508
17	Phosphorylation	TSSSSSSSSNQQTEK CCCCCCCCCCCCCCC	34.94	26160508
18	Phosphorylation	SSSSSSSSNQQTEKE CCCCCCCCCCCCCCC	40.37	26160508
22	Phosphorylation	SSSSNQQTEKEGSTP CCCCCCCCCCCCCCC	38.98	22345495
27	Phosphorylation	QQTEKEGSTPKKKES CCCCCCCCCCCHHHH	42.50	22345495
28	Phosphorylation	QTEKEGSTPKKKESK CCCCCCCCCCHHHHC	50.40	22345495
43	Ubiquitination	VSMSKNSKLLSTSAK CCCCHHHHHHHHHHH	63.94	22790023
46	Phosphorylation	SKNSKLLSTSAKRIQ CHHHHHHHHHHHHHH	30.65	29176673
47	Phosphorylation	KNSKLLSTSAKRIQK HHHHHHHHHHHHHHH	32.45	29176673
48	Phosphorylation	NSKLLSTSAKRIQKE HHHHHHHHHHHHHHH	28.54	29176673
77	Phosphorylation	GPKGDNIYEWRSTIL CCCCCCEEEECCCEE	18.72	22817900
131	S-palmitoylation	INSQGVICLDILKDN CCCCCEEEEEHHCCC	2.31	28680068
136	Ubiquitination	VICLDILKDNWSPAL EEEEEHHCCCCCCCH	49.72	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UB2E1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UB2E1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UB2E1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NF2L2_HUMAN	NFE2L2	physical	20484052
ARI2_MOUSE	Arih2	physical	11722579

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.