UniProt ID | TXN4B_HUMAN | |
---|---|---|
UniProt AC | Q9NX01 | |
Protein Name | Thioredoxin-like protein 4B | |
Gene Name | TXNL4B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 149 | |
Subcellular Localization | Nucleus . | |
Protein Description | Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.. | |
Protein Sequence | MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSFLLPKLT ------CCCCHHHCC | 25.30 | 24719451 | |
7 | Ubiquitination | -MSFLLPKLTSKKEV -CCCCHHHCCCHHHH | 65.45 | 22505724 | |
9 | Phosphorylation | SFLLPKLTSKKEVDQ CCCHHHCCCHHHHHH | 44.63 | 24719451 | |
19 | Ubiquitination | KEVDQAIKSTAEKVL HHHHHHHHHHHCEEE | 44.78 | 33845483 | |
24 | Ubiquitination | AIKSTAEKVLVLRFG HHHHHHCEEEEEEEC | 38.10 | - | |
47 | Ubiquitination | QLDDILSKTSSDLSK EHHHHHHHCCCHHHH | 49.32 | 29967540 | |
53 | Ubiquitination | SKTSSDLSKMAAIYL HHCCCHHHHCEEEEE | 25.94 | 27667366 | |
83 | Ubiquitination | SYIPSTVFFFNGQHM ECCCCEEEEECCEEE | 6.15 | 29967540 | |
87 | Ubiquitination | STVFFFNGQHMKVDY CEEEEECCEEEEECC | 17.39 | 29967540 | |
96 | Phosphorylation | HMKVDYGSPDHTKFV EEEECCCCCCCCCEE | 22.41 | 25159151 | |
101 | Ubiquitination | YGSPDHTKFVGSFKT CCCCCCCCEEECCCC | 34.33 | 29967540 | |
107 | Ubiquitination | TKFVGSFKTKQDFID CCEEECCCCHHHHHH | 57.41 | 27667366 | |
127 | Ubiquitination | YRGAMRGKLIVQSPI HHHHHCCCEEEECCC | 25.36 | - | |
127 | Acetylation | YRGAMRGKLIVQSPI HHHHHCCCEEEECCC | 25.36 | 25953088 | |
132 | Phosphorylation | RGKLIVQSPIDPKNI CCCEEEECCCCCCCC | 16.96 | 30266825 | |
137 | Ubiquitination | VQSPIDPKNIPKYDL EECCCCCCCCCCHHC | 64.86 | 29967540 | |
141 | Ubiquitination | IDPKNIPKYDLLYQD CCCCCCCCHHCEECC | 47.82 | 29967540 | |
142 | Phosphorylation | DPKNIPKYDLLYQDI CCCCCCCHHCEECCC | 13.38 | 28796482 | |
146 | Phosphorylation | IPKYDLLYQDI---- CCCHHCEECCC---- | 16.07 | 28796482 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXN4B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXN4B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXN4B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRP6_HUMAN | PRPF6 | physical | 15161931 | |
XPO1_HUMAN | XPO1 | physical | 21048991 | |
RIOK2_HUMAN | RIOK2 | physical | 21048991 | |
NOB1_HUMAN | NOB1 | physical | 21048991 | |
RS3_HUMAN | RPS3 | physical | 21048991 | |
PKHF2_HUMAN | PLEKHF2 | physical | 25416956 | |
PNMA5_HUMAN | PNMA5 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, AND MASSSPECTROMETRY. |