dbPTM

TX19A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TX19A_MOUSE
UniProt AC	Q99MV2
Protein Name	Testis-expressed protein 19.1 {ECO:0000305}
Gene Name	Tex19.1 {ECO:0000312\|MGI:MGI:1920929}
Organism	Mus musculus (Mouse).
Sequence Length	351
Subcellular Localization	Cytoplasm . Was initially reported to localize in the nucleus (PubMed:18096721). However, it was later shown to localize in cytoplasm only (PubMed:18802469). Cytoplasmic localization is distinct from the meiotic nuage, also named P granule, a germ-ce
Protein Description	Required during spermatogenesis and placenta development, participating in the repression of retrotransposable elements and preventing their mobilization. [PubMed: 18802469]
Protein Sequence	MCPPVSVRHGARGMSCLYEAWLYHLVHGEQTKICFACFKAAFLLNKLYLEMGDWQEEEEEEEEEDADLLEYLSESESESEQEPGPEQDAWRGLGSLYVPQSVSEGSGVLLPTPVWTQGILFSIFVPTELFPQEAVPLDLGPEDAEWTQALPWRLDGLFPCSHQLIPPLTWWDIFDVMPSPGQPVLLELRCHWPLDQTVAQSWLQDQKFVLLLDSVQSRCHLLSMRVRWVVRTQVQHWQVLLDPGEMWVAHFRKEVGQHGLYHQSLNPWRLSILTASELGMELLPATCYLWNKGFWVGSFLPWHINMPETWSWEPGERLFITDATICGTDYHLAQSFLDSHPTPHPLLTLTP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
46	Ubiquitination	KAAFLLNKLYLEMGD HHHHHHHHHHHHCCC	38.18	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TX19A_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TX19A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TX19A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBR2_MOUSE	Ubr2	physical	21103378

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TX19A_MOUSE

Related Literatures of Post-Translational Modification