UniProt ID | TX19A_MOUSE | |
---|---|---|
UniProt AC | Q99MV2 | |
Protein Name | Testis-expressed protein 19.1 {ECO:0000305} | |
Gene Name | Tex19.1 {ECO:0000312|MGI:MGI:1920929} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 351 | |
Subcellular Localization | Cytoplasm . Was initially reported to localize in the nucleus (PubMed:18096721). However, it was later shown to localize in cytoplasm only (PubMed:18802469). Cytoplasmic localization is distinct from the meiotic nuage, also named P granule, a germ-ce | |
Protein Description | Required during spermatogenesis and placenta development, participating in the repression of retrotransposable elements and preventing their mobilization. [PubMed: 18802469] | |
Protein Sequence | MCPPVSVRHGARGMSCLYEAWLYHLVHGEQTKICFACFKAAFLLNKLYLEMGDWQEEEEEEEEEDADLLEYLSESESESEQEPGPEQDAWRGLGSLYVPQSVSEGSGVLLPTPVWTQGILFSIFVPTELFPQEAVPLDLGPEDAEWTQALPWRLDGLFPCSHQLIPPLTWWDIFDVMPSPGQPVLLELRCHWPLDQTVAQSWLQDQKFVLLLDSVQSRCHLLSMRVRWVVRTQVQHWQVLLDPGEMWVAHFRKEVGQHGLYHQSLNPWRLSILTASELGMELLPATCYLWNKGFWVGSFLPWHINMPETWSWEPGERLFITDATICGTDYHLAQSFLDSHPTPHPLLTLTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Ubiquitination | KAAFLLNKLYLEMGD HHHHHHHHHHHHCCC | 38.18 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TX19A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TX19A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TX19A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBR2_MOUSE | Ubr2 | physical | 21103378 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...