| UniProt ID | TWST2_HUMAN | |
|---|---|---|
| UniProt AC | Q8WVJ9 | |
| Protein Name | Twist-related protein 2 | |
| Gene Name | TWIST2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 160 | |
| Subcellular Localization | Nucleus . Cytoplasm . Mainly nuclear during embryonic development. Cytoplasmic in adult tissues. | |
| Protein Description | Binds to the E-box consensus sequence 5'-CANNTG-3' as a heterodimer and inhibits transcriptional activation by MYOD1, MYOG, MEF2A and MEF2C. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Involved in postnatal glycogen storage and energy metabolism (By similarity). Inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors.. | |
| Protein Sequence | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | O-linked_Glycosylation | FGRKRRYSKKSSEDG HCCCCCCCCCCCCCC | 31.62 | 31492838 | |
| 40 | O-linked_Glycosylation | RRYSKKSSEDGSPTP CCCCCCCCCCCCCCC | 48.89 | 31492838 | |
| 55 | Phosphorylation | GKRGKKGSPSAQSFE CCCCCCCCCCHHCHH | 25.26 | 30266825 | |
| 57 | Phosphorylation | RGKKGSPSAQSFEEL CCCCCCCCHHCHHHH | 40.41 | 30266825 | |
| 60 | Phosphorylation | KGSPSAQSFEELQSQ CCCCCHHCHHHHHHH | 34.05 | 23403867 | |
| 66 | Phosphorylation | QSFEELQSQRILANV HCHHHHHHHHHHHHH | 33.77 | - | |
| 79 | Phosphorylation | NVRERQRTQSLNEAF HHHHHHHHHHHHHHH | 17.74 | - | |
| 81 | Phosphorylation | RERQRTQSLNEAFAA HHHHHHHHHHHHHHH | 32.33 | 20400976 | |
| 95 | Phosphorylation | ALRKIIPTLPSDKLS HHHHHHCCCCHHHHH | 40.67 | - | |
| 100 | Ubiquitination | IPTLPSDKLSKIQTL HCCCCHHHHHHHHHH | 60.02 | - | |
| 102 | Phosphorylation | TLPSDKLSKIQTLKL CCCHHHHHHHHHHHH | 33.19 | 25003641 | |
| 103 | Ubiquitination | LPSDKLSKIQTLKLA CCHHHHHHHHHHHHH | 49.63 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TWST2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TWST2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TWST2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MEF2C_HUMAN | MEF2C | physical | 11809751 | |
| ETS2_HUMAN | ETS2 | physical | 18598946 | |
| CCM2_HUMAN | CCM2 | physical | 25814554 | |
| HTF4_HUMAN | TCF12 | physical | 21516116 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 227260 | Focal facial dermal dysplasia 3, Setleis type (FFDD3) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
