UniProt ID | TSN13_HUMAN | |
---|---|---|
UniProt AC | O95857 | |
Protein Name | Tetraspanin-13 | |
Gene Name | TSPAN13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 204 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | S-palmitoylation | -----MVCGGFACSK -----CCCCCCCCCH | 4.21 | 29575903 | |
8 | S-palmitoylation | MVCGGFACSKNCLCA CCCCCCCCCHHHHHH | 5.78 | 29575903 | |
41 | Phosphorylation | GIGFGLISSLRVVGV HHCHHHHHHHHHHHH | 28.50 | 24719451 | |
42 | Phosphorylation | IGFGLISSLRVVGVV HCHHHHHHHHHHHHH | 17.13 | 25954137 | |
113 | N-linked_Glycosylation | QLLEVGWNNTASARN CEEEECCCCHHHHHH | 30.00 | UniProtKB CARBOHYD | |
137 | N-linked_Glycosylation | GFRSVNPNDTCLASC CCCCCCCCCCEEHHH | 52.61 | 17660510 | |
139 | Phosphorylation | RSVNPNDTCLASCVK CCCCCCCCEEHHHHC | 18.96 | 25262027 | |
143 | Phosphorylation | PNDTCLASCVKSDHS CCCCEEHHHHCCCCC | 13.39 | 25849741 | |
201 | Phosphorylation | KDPRANPSAFL---- CCCCCCCCCCC---- | 31.31 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSN13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSN13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSN13_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...