UniProt ID | TSLP_HUMAN | |
---|---|---|
UniProt AC | Q969D9 | |
Protein Name | Thymic stromal lymphopoietin | |
Gene Name | TSLP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 159 | |
Subcellular Localization | Secreted . | |
Protein Description | Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.; Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin.. | |
Protein Sequence | MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MFPFALLYVLSVSFR CCCHHHHHHHHHHHH | 10.53 | 24043423 | |
11 | Phosphorylation | FALLYVLSVSFRKIF HHHHHHHHHHHHHHH | 12.98 | 24043423 | |
13 | Phosphorylation | LLYVLSVSFRKIFIL HHHHHHHHHHHHHHH | 18.89 | 24719451 | |
43 | Phosphorylation | FEKIKAAYLSTISKD HHHHHHHHHHHHCHH | 13.17 | 24114839 | |
48 | Phosphorylation | AAYLSTISKDLITYM HHHHHHHCHHHHHHH | 21.87 | 24114839 | |
64 | N-linked_Glycosylation | GTKSTEFNNTVSCSN CCCCCEECCCCCCCC | 36.71 | UniProtKB CARBOHYD | |
119 | N-linked_Glycosylation | GYSETQINATQAMKK CCCHHHCCHHHHHHH | 27.41 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSLP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSLP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSLP_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...