UniProt ID | TRNL_YEAST | |
---|---|---|
UniProt AC | P09880 | |
Protein Name | tRNA ligase | |
Gene Name | TRL1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 827 | |
Subcellular Localization | ||
Protein Description | One of the two proteins required for the splicing of precursor tRNA molecules containing introns. The ligation activity requires three enzymatic activities: phosphorylation of the 5' terminus of the 3' half-tRNA in the presence of ATP, opening of the 2'3'-cyclic phosphodiester bond of the 5' half-tRNA leaving a 2'-phosphomonoester and ligation of the two tRNA halves in an ATP-dependent reaction.. | |
Protein Sequence | MPSPYDGKRTVTQLVNELEKAEKLSGRGRAYRRVCDLSHSNKKVISWKFNEWDYGKNTITLPCNARGLFISDDTTNPVIVARGYDKFFNVGEVNFTKWNWIEENCTGPYDVTIKANGCIIFISGLEDGTLVVCSKHSTGPRADVDRNHAEAGEKQLLRQLAAMNINRSDFARMLYTHNVTAVAEYCDDSFEEHILEYPLEKAGLYLHGVNVNKAEFETWDMKDVSQMASKYGFRCVQCITSNTLEDLKKFLDNCSATGSFEGQEIEGFVIRCHLKSTEKPFFFKYKFEEPYLMYRQWREVTKDYISNKSRVFKFRKHKFITNKYLDFAIPILESSPKICENYLKGFGVIELRNKFLQSYGMSGLEILNHEKVAELELKNAIDYDKVDERTKFLIFPISVIGCGKTTTSQTLVNLFPDSWGHIQNDDITGKDKSQLMKKSLELLSKKEIKCVIVDRNNHQFRERKQLFEWLNELKEDYLVYDTNIKVIGVSFAPYDKLSEIRDITLQRVIKRGNNHQSIKWDELGEKKVVGIMNGFLKRYQPVNLDKSPDNMFDLMIELDFGQADSSLTNAKQILNEIHKAYPILVPEIPKDDEIETAFRRSLDYKPTVRKIVGKGNNNQQKTPKLIKPTYISAKIENYDEIIELVKRCIASDAELTEKFKHLLASGKVQKELHITLGHVMSSREKEAKKLWKSYCNRYTDQITEYNNNRIENAQGSGNNQNTQVKTTDKLNFRLEKLCWDEKIIAIVVELSKDKDGCIIDENNEKIKGLCCQNKIPHITLCKLESGVKAVYSNVLCEKVESAEVDENIKVVKLDNSKEFVGSVYLNF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | YDGKRTVTQLVNELE CCCHHHHHHHHHHHH | 18.64 | 28889911 | |
20 | Acetylation | QLVNELEKAEKLSGR HHHHHHHHHHHHCCC | 74.58 | 24489116 | |
86 | Acetylation | IVARGYDKFFNVGEV EEEECCCCCCCCCCC | 43.29 | 24489116 | |
168 | Phosphorylation | AAMNINRSDFARMLY HHCCCCHHHHHHHHH | 32.37 | 29688323 | |
284 | Acetylation | TEKPFFFKYKFEEPY CCCCEEEEEEECCCC | 42.23 | 24489116 | |
286 | Acetylation | KPFFFKYKFEEPYLM CCEEEEEEECCCCHH | 47.06 | 24489116 | |
309 | Phosphorylation | KDYISNKSRVFKFRK HHHHHCCCCEEEECC | 37.62 | 28889911 | |
446 | Acetylation | SLELLSKKEIKCVIV HHHHHHCCCCEEEEE | 62.39 | 25381059 | |
449 | Acetylation | LLSKKEIKCVIVDRN HHHCCCCEEEEECCC | 24.44 | 25381059 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRNL_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRNL_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRNL_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YPT6_YEAST | YPT6 | genetic | 19061648 | |
TRNL_SCHPO | trl1 | genetic | 20844078 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...