TRIM9_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRIM9_MOUSE
• UniProt AC: Q8C7M3
• Protein Name: E3 ubiquitin-protein ligase TRIM9
• Gene Name: Trim9
• Organism: Mus musculus (Mouse).
• Sequence Length: 817
• Subcellular Localization: Cytoplasm . Cell projection, dendrite . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle . Cell junction, synapse . Cytoplasm, cytoskeleton . Enriched at synaptic terminals where it exists in a soluble form and a synaptic vesicle-associated f
• Protein Description: E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation..
• Protein Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEAAGAHETKPMKDTDSEEQTLPFPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDFRSSPHQLSLHSSLQSLNAPGCNFETQSASYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGLFFPAVSLNRNVQVSLWAPGLRACSGCYFKVCPGAVKSPQAPAP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	ARNILVQTPESESPQ HHHCCCCCCCCCCCC	22.88	25521595
44	Phosphorylation	ILVQTPESESPQSRR CCCCCCCCCCCCCCC	44.57	25521595
46	Phosphorylation	VQTPESESPQSRRAS CCCCCCCCCCCCCCC	37.20	25521595
49	Phosphorylation	PESESPQSRRASGSG CCCCCCCCCCCCCCC	27.41	29899451
53	Phosphorylation	SPQSRRASGSGVSDY CCCCCCCCCCCCCCC	31.51	25521595
55	Phosphorylation	QSRRASGSGVSDYDY CCCCCCCCCCCCCCC	33.26	25521595
58	Phosphorylation	RASGSGVSDYDYLDL CCCCCCCCCCCCCCH	33.70	28066266
437	Phosphorylation	DFVQVKASSPVPATP CEEEEEECCCCCCCC	29.47	29899451
443	Phosphorylation	ASSPVPATPILQLEE ECCCCCCCCEEEHHH	12.56	21082442
569	Phosphorylation	RLPLRRMSPFSSTLN CCCCCCCCCCCCCCC	22.45	19060867
580	Phosphorylation	STLNLQPSFPGRSYF CCCCCCCCCCCCCCC	30.98	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRIM9_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRIM9_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRIM9_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GLU2B_MOUSE	Prkcsh	physical	22337885

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.