UniProt ID | TRI52_HUMAN | |
---|---|---|
UniProt AC | Q96A61 | |
Protein Name | Tripartite motif-containing protein 52 | |
Gene Name | TRIM52 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 297 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MAGYATTPSPMQTL -CCCCCCCCCHHHHH | 17.38 | 30576142 | |
9 | Phosphorylation | AGYATTPSPMQTLQE CCCCCCCCHHHHHHH | 30.80 | 30576142 | |
189 | Phosphorylation | TCPQCRKSFTRRSFR CCHHHHHHCCCCCCC | 16.70 | 22210691 | |
229 | Ubiquitination | NDQGMCFKHQEALKL CCCCCCCCHHHHHHH | 39.18 | - | |
235 | Ubiquitination | FKHQEALKLFCEVDK CCHHHHHHHHEECCC | 46.71 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRI52_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRI52_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRI52_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...