TRI52_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRI52_HUMAN
• UniProt AC: Q96A61
• Protein Name: Tripartite motif-containing protein 52
• Gene Name: TRIM52
• Organism: Homo sapiens (Human).
• Sequence Length: 297
• Protein Sequence: MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MAGYATTPSPMQTL -CCCCCCCCCHHHHH	17.38	30576142
9	Phosphorylation	AGYATTPSPMQTLQE CCCCCCCCHHHHHHH	30.80	30576142
189	Phosphorylation	TCPQCRKSFTRRSFR CCHHHHHHCCCCCCC	16.70	22210691
229	Ubiquitination	NDQGMCFKHQEALKL CCCCCCCCHHHHHHH	39.18	-
235	Ubiquitination	FKHQEALKLFCEVDK CCHHHHHHHHEECCC	46.71	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRI52_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRI52_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRI52_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.