TPPC3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TPPC3_MOUSE
• UniProt AC: O55013
• Protein Name: Trafficking protein particle complex subunit 3
• Gene Name: Trappc3
• Organism: Mus musculus (Mouse).
• Sequence Length: 180
• Subcellular Localization: Golgi apparatus, cis-Golgi network. Endoplasmic reticulum.
• Protein Description: May play a role in vesicular transport from endoplasmic reticulum to Golgi..
• Protein Sequence: MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSALIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	KMSSELFTLTYGALV CHHHHHHHHHHHHHH	30.71	28576409
68	S-palmitoylation	ARSNVGRCHDFRETA HHCCCCCCCCHHHHH	2.72	26165157
156	Ubiquitination	KFVQDTLKGDGVTEI HHHHHHHCCCCCCHH	57.98	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TPPC3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TPPC3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TPPC3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TPPC1_MOUSE	Trappc1	physical	17027922

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.