UniProt ID | TPPC3_MOUSE | |
---|---|---|
UniProt AC | O55013 | |
Protein Name | Trafficking protein particle complex subunit 3 | |
Gene Name | Trappc3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 180 | |
Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
Protein Sequence | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSALIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | KMSSELFTLTYGALV CHHHHHHHHHHHHHH | 30.71 | 28576409 | |
68 | S-palmitoylation | ARSNVGRCHDFRETA HHCCCCCCCCHHHHH | 2.72 | 26165157 | |
156 | Ubiquitination | KFVQDTLKGDGVTEI HHHHHHHCCCCCCHH | 57.98 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPC3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPC3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPC3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPPC1_MOUSE | Trappc1 | physical | 17027922 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...