UniProt ID | TPPC1_MOUSE | |
---|---|---|
UniProt AC | Q5NCF2 | |
Protein Name | Trafficking protein particle complex subunit 1 | |
Gene Name | Trappc1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 145 | |
Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
Protein Sequence | MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Phosphorylation | RSFVSKMSPLDMKDG HHHHHHCCCCCCCCC | 26.50 | 21183079 | |
66 | Phosphorylation | DGFLSFQTSRYKLHY CCEEEEECEEEEEEE | 17.11 | 21183079 | |
67 | Phosphorylation | GFLSFQTSRYKLHYY CEEEEECEEEEEEEE | 23.88 | 21183079 | |
128 | Phosphorylation | VQSELFRSRLDSYVR HHHHHHHHHHHHHHH | 29.84 | 29472430 | |
132 | Phosphorylation | LFRSRLDSYVRSLPF HHHHHHHHHHHHCCC | 30.07 | 24899341 | |
133 | Phosphorylation | FRSRLDSYVRSLPFF HHHHHHHHHHHCCCC | 10.27 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPC1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPC1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPC1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TPPC1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...