TPPC1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TPPC1_MOUSE
• UniProt AC: Q5NCF2
• Protein Name: Trafficking protein particle complex subunit 1
• Gene Name: Trappc1
• Organism: Mus musculus (Mouse).
• Sequence Length: 145
• Subcellular Localization: Golgi apparatus, cis-Golgi network. Endoplasmic reticulum.
• Protein Description: May play a role in vesicular transport from endoplasmic reticulum to Golgi..
• Protein Sequence: MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	RSFVSKMSPLDMKDG HHHHHHCCCCCCCCC	26.50	21183079
66	Phosphorylation	DGFLSFQTSRYKLHY CCEEEEECEEEEEEE	17.11	21183079
67	Phosphorylation	GFLSFQTSRYKLHYY CEEEEECEEEEEEEE	23.88	21183079
128	Phosphorylation	VQSELFRSRLDSYVR HHHHHHHHHHHHHHH	29.84	29472430
132	Phosphorylation	LFRSRLDSYVRSLPF HHHHHHHHHHHHCCC	30.07	24899341
133	Phosphorylation	FRSRLDSYVRSLPFF HHHHHHHHHHHCCCC	10.27	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TPPC1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TPPC1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TPPC1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TPPC1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.