UniProt ID | TPD55_HUMAN | |
---|---|---|
UniProt AC | Q96J77 | |
Protein Name | Tumor protein D55 | |
Gene Name | TPD52L3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | Phosphorylation | VGLRQNLSKSWLDVQ HHHHHHHCHHCCEEE | 31.99 | 30622161 | |
79 | Phosphorylation | LRQNLSKSWLDVQVS HHHHHCHHCCEEEEC | 29.51 | 30622161 | |
115 | Phosphorylation | KLGGVKKSATFRSFE HHCCCCCCCEEHHHC | 27.16 | - | |
120 | Phosphorylation | KKSATFRSFEGLMGT CCCCEEHHHCHHHHH | 24.37 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPD55_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPD55_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPD55_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
CKLF5_HUMAN | CMTM5 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...