TP8L2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TP8L2_HUMAN
• UniProt AC: Q6P589
• Protein Name: Tumor necrosis factor alpha-induced protein 8-like protein 2
• Gene Name: TNFAIP8L2
• Organism: Homo sapiens (Human).
• Sequence Length: 184
• Protein Description: Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis (By similarity)..
• Protein Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MESFSSKSLA -----CCCCCHHHHH	29.18	29083192
5	Phosphorylation	---MESFSSKSLALQ ---CCCCCHHHHHHH	46.25	28509920
6	Phosphorylation	--MESFSSKSLALQA --CCCCCHHHHHHHH	25.01	28509920
8	Phosphorylation	MESFSSKSLALQAEK CCCCCHHHHHHHHHH	22.33	28509920
78	Phosphorylation	AVLHRNGSFGPSELA HHHCCCCCCCHHHHH	30.49	28450419
82	Phosphorylation	RNGSFGPSELALATR CCCCCCHHHHHHHHH	45.69	27134283
88	Phosphorylation	PSELALATRFRQKLR HHHHHHHHHHHHHHH	31.06	27134283
136	Phosphorylation	ELVEHHLTPKSHGRI HHHHHHCCCCCCCCH	25.06	27251275
183	Ubiquitination	RKLLDEGKL------ HHHHHCCCC------	49.31	24816145

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
3	S	Phosphorylation	Kinase	TAK1	O43318	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TP8L2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TP8L2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TES_HUMAN	TES	physical	26186194
AHNK2_HUMAN	AHNAK2	physical	26186194
TES_HUMAN	TES	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.