UniProt ID | TP8L1_HUMAN | |
---|---|---|
UniProt AC | Q8WVP5 | |
Protein Name | Tumor necrosis factor alpha-induced protein 8-like protein 1 | |
Gene Name | TNFAIP8L1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 186 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Acts as a negative regulator of mTOR activity.. | |
Protein Sequence | MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MDTFSTKSLALQAQ -CCCCCHHHHHHHHH | 42.12 | 23000965 | |
8 | Phosphorylation | MDTFSTKSLALQAQK CCCCCHHHHHHHHHH | 20.97 | 30622161 | |
15 | Ubiquitination | SLALQAQKKLLSKMA HHHHHHHHHHHHHHH | 48.69 | 29967540 | |
136 | Phosphorylation | QAVGPHLTAKSHGRI HHHCCCCCHHHCCCH | 29.07 | 28348404 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TP8L1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TP8L1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TP8L1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
FBXW5_HUMAN | FBXW5 | physical | 24444419 | |
FBXW5_HUMAN | FBXW5 | physical | 24372178 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...