TP8L1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TP8L1_HUMAN
• UniProt AC: Q8WVP5
• Protein Name: Tumor necrosis factor alpha-induced protein 8-like protein 1
• Gene Name: TNFAIP8L1
• Organism: Homo sapiens (Human).
• Sequence Length: 186
• Subcellular Localization: Cytoplasm .
• Protein Description: Acts as a negative regulator of mTOR activity..
• Protein Sequence: MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Ubiquitination	-MDTFSTKSLALQAQ -CCCCCHHHHHHHHH	42.12	23000965
8	Phosphorylation	MDTFSTKSLALQAQK CCCCCHHHHHHHHHH	20.97	30622161
15	Ubiquitination	SLALQAQKKLLSKMA HHHHHHHHHHHHHHH	48.69	29967540
136	Phosphorylation	QAVGPHLTAKSHGRI HHHCCCCCHHHCCCH	29.07	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TP8L1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TP8L1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TP8L1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
FBXW5_HUMAN	FBXW5	physical	24444419
FBXW5_HUMAN	FBXW5	physical	24372178

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.