UniProt ID | TON2_ARATH | |
---|---|---|
UniProt AC | Q9FEE2 | |
Protein Name | Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 | |
Gene Name | TON2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 480 | |
Subcellular Localization | Cytoplasm . Cytoplasm, cytoskeleton . Predominantly cytoplasmic, but at the late G2 phase localizes at the cortical region corresponding to the preprophase band. | |
Protein Description | Probable regulatory subunit of type 2A protein phosphatase involved in the control of the dynamic organization of the cortical cytoskeleton. Plays an important role in the organization of interphase microtubule arrays in part through the regulation of nucleation geometry. Required for the reorganization of cortical arrays in response to light.. | |
Protein Sequence | MYSGSSDGESHDTSTQRKIPPASSMLWVRNLRRYIGSGAGLGSEALMELETKRILLEIFKEKQQKSQEAGTIPSFYKKKPEEGSISQRVQKLAKYRFLKKQSDLLLNADDLAAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDEAGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLHSDEMESYIGGLIPNLAQLRDMPPAFNQMYCRIASQKFFFFCDPHRRGRACIKKILLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRICDMFLALDKDMSGSLCKQELKEYADGTLTEIFIERVFDEHVRRGKIVAGNSREMDFDSFLDFVLALENKDTPEGLTYLFRCLDLQGRGFLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPSDPLKITLGDLLGCKQGGTVASMLIDVRGFWAHDNRENLLQEEEEPPEEESQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MYSGSSDGES -----CCCCCCCCCC | 29654922 | ||
5 | Phosphorylation | ---MYSGSSDGESHD ---CCCCCCCCCCCC | 25561503 | ||
6 | Phosphorylation | --MYSGSSDGESHDT --CCCCCCCCCCCCC | 25561503 | ||
479 | Phosphorylation | EEPPEEESQ------ CCCCHHHCC------ | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TON2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TON2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TON2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
2AAG_ARATH | PP2AA3 | physical | 11971138 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...