TON2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TON2_ARATH
• UniProt AC: Q9FEE2
• Protein Name: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2
• Gene Name: TON2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 480
• Subcellular Localization: Cytoplasm . Cytoplasm, cytoskeleton . Predominantly cytoplasmic, but at the late G2 phase localizes at the cortical region corresponding to the preprophase band.
• Protein Description: Probable regulatory subunit of type 2A protein phosphatase involved in the control of the dynamic organization of the cortical cytoskeleton. Plays an important role in the organization of interphase microtubule arrays in part through the regulation of nucleation geometry. Required for the reorganization of cortical arrays in response to light..
• Protein Sequence: MYSGSSDGESHDTSTQRKIPPASSMLWVRNLRRYIGSGAGLGSEALMELETKRILLEIFKEKQQKSQEAGTIPSFYKKKPEEGSISQRVQKLAKYRFLKKQSDLLLNADDLAAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDEAGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLHSDEMESYIGGLIPNLAQLRDMPPAFNQMYCRIASQKFFFFCDPHRRGRACIKKILLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRICDMFLALDKDMSGSLCKQELKEYADGTLTEIFIERVFDEHVRRGKIVAGNSREMDFDSFLDFVLALENKDTPEGLTYLFRCLDLQGRGFLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPSDPLKITLGDLLGCKQGGTVASMLIDVRGFWAHDNRENLLQEEEEPPEEESQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MYSGSSDGES -----CCCCCCCCCC		29654922
5	Phosphorylation	---MYSGSSDGESHD ---CCCCCCCCCCCC		25561503
6	Phosphorylation	--MYSGSSDGESHDT --CCCCCCCCCCCCC		25561503
479	Phosphorylation	EEPPEEESQ------ CCCCHHHCC------		25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TON2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TON2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TON2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
2AAG_ARATH	PP2AA3	physical	11971138

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.