TO204_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TO204_ARATH
• UniProt AC: P82805
• Protein Name: Mitochondrial import receptor subunit TOM20-4
• Gene Name: TOM20-4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 187
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein .
• Protein Description: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore..
• Protein Sequence: MDMQNENERLMVFEHARKVAEATYVKNPLDAENLTRWAGALLELSQFQTEPKQMILEAILKLGEALVIDPKKHDALWLIGNAHLSFGFLSSDQTEASDNFEKASQFFQLAVEEQPESELYRKSLTLASKAPELHTGGTAGPSSNSAKTMKQKKTSEFKYDVFGWVILASYVVAWISFANSQTPVSRQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDMQNENE -------CCCCCHHH	9.75	-
123	Phosphorylation	ESELYRKSLTLASKA CHHHHHHHHHHHHHC	20.00	19376835
125	Phosphorylation	ELYRKSLTLASKAPE HHHHHHHHHHHHCCC	27.63	19376835
128	Phosphorylation	RKSLTLASKAPELHT HHHHHHHHHCCCCCC	32.25	19376835
135	Phosphorylation	SKAPELHTGGTAGPS HHCCCCCCCCCCCCC	50.35	19376835
138	Phosphorylation	PELHTGGTAGPSSNS CCCCCCCCCCCCCCC	29.77	19376835
142	Phosphorylation	TGGTAGPSSNSAKTM CCCCCCCCCCCHHHH	41.03	19376835
143	Phosphorylation	GGTAGPSSNSAKTMK CCCCCCCCCCHHHHH	37.63	19376835
145	Phosphorylation	TAGPSSNSAKTMKQK CCCCCCCCHHHHHCC	32.84	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TO204_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TO204_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TO204_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AOX1_SOYBN	AOX1	physical	17981999
ATP7_ARATH	MGP1	physical	17981999
TO401_ARATH	TOM40	physical	17981999
GSHRP_ARATH	GR	physical	17981999

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-143, AND MASSSPECTROMETRY.
PubMed: 19376835