UniProt ID | TNNC2_RABIT | |
---|---|---|
UniProt AC | P02586 | |
Protein Name | Troponin C, skeletal muscle | |
Gene Name | TNNC2 | |
Organism | Oryctolagus cuniculus (Rabbit). | |
Sequence Length | 160 | |
Subcellular Localization | ||
Protein Description | Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.. | |
Protein Sequence | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTDQQAEAR ------CCHHHHHHH | 42.38 | 893419 | |
21 | Acetylation | EEMIAEFKAAFDMFD HHHHHHHHHHHHHCC | 30.25 | 7662676 | |
38 | Acetylation | GGGDISVKELGTVMR CCCCEEHHHHHHHHH | 40.19 | 7662676 | |
53 | Acetylation | MLGQTPTKEELDAII HHCCCCCHHHHHHHH | 50.85 | 7662676 | |
85 | Acetylation | VMMVRQMKEDAKGKS HHHHHHHHHHHCCCC | 44.07 | 7662676 | |
89 | Acetylation | RQMKEDAKGKSEEEL HHHHHHHCCCCHHHH | 78.26 | 7662676 | |
89 | Ubiquitination | RQMKEDAKGKSEEEL HHHHHHHCCCCHHHH | 78.26 | - | |
91 | Acetylation | MKEDAKGKSEEELAE HHHHHCCCCHHHHHH | 54.72 | 7662676 | |
91 | Ubiquitination | MKEDAKGKSEEELAE HHHHHCCCCHHHHHH | 54.72 | - | |
137 | Acetylation | EEIESLMKDGDKNND HHHHHHHHHCCCCCC | 64.95 | 7662676 | |
141 | Acetylation | SLMKDGDKNNDGRID HHHHHCCCCCCCCCC | 64.28 | 7662676 | |
154 | Acetylation | IDFDEFLKMMEGVQ- CCHHHHHHHHHCCC- | 41.33 | 7662676 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC2_RABIT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC2_RABIT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC2_RABIT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNNI2_RABIT | TNNI2 | physical | 9724539 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...