| UniProt ID | TNMD_HUMAN | |
|---|---|---|
| UniProt AC | Q9H2S6 | |
| Protein Name | Tenomodulin | |
| Gene Name | TNMD | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 317 | |
| Subcellular Localization |
Isoform 1: Membrane Single-pass type II membrane protein . Nucleus envelope. Isoform 2: Membrane Single-pass type II membrane protein . Nucleus envelope. Isoform 3: Cytoplasm. |
|
| Protein Description | May be an angiogenesis inhibitor.. | |
| Protein Sequence | MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKKAYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Acetylation | AEAFKSKKICKSLKI HHHHCCHHHHHHHHH | 61.50 | 7297979 | |
| 85 | Phosphorylation | YMEIDPVTRTEIFRS EEEECCCCCEEEEEC | 36.94 | 22210691 | |
| 87 | Phosphorylation | EIDPVTRTEIFRSGN EECCCCCEEEEECCC | 24.86 | 22210691 | |
| 94 | N-linked_Glycosylation | TEIFRSGNGTDETLE EEEEECCCCCCCEEE | 51.98 | UniProtKB CARBOHYD | |
| 99 | Phosphorylation | SGNGTDETLEVHDFK CCCCCCCEEEEEECC | 30.91 | 22210691 | |
| 180 | N-linked_Glycosylation | KILEICDNVTMYWIN CHHHCCCCEEEEEEC | 27.09 | UniProtKB CARBOHYD | |
| 239 | Phosphorylation | TRHARQASEEELPIN CCHHHHCCCCCCCCC | 36.88 | - | |
| 286 | Phosphorylation | VCEPLLGYYPYPYCY HHHHHHCCCCCCCEE | 10.96 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNMD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNMD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNMD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TMM79_HUMAN | TMEM79 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...