UniProt ID | TMM53_HUMAN | |
---|---|---|
UniProt AC | Q6P2H8 | |
Protein Name | Transmembrane protein 53 | |
Gene Name | TMEM53 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 277 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHKRGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLYRYVLELLQTRRFCRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALVVVLFHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | PCWSQKNSPSPGGKE CCCCCCCCCCCCCCC | 33.52 | 26425664 | |
25 | Phosphorylation | WSQKNSPSPGGKEAE CCCCCCCCCCCCCCC | 35.68 | 26425664 | |
29 | Ubiquitination | NSPSPGGKEAETRQP CCCCCCCCCCCCCCC | 60.72 | - | |
58 | Phosphorylation | LAKYSAIYHKRGCIV HHHHHHHEECCCEEE | 10.87 | - | |
68 | Phosphorylation | RGCIVIRYTAPWHMV CCEEEEEECCCCEEE | 8.98 | - | |
69 | Phosphorylation | GCIVIRYTAPWHMVF CEEEEEECCCCEEEE | 19.18 | 25332170 | |
85 | Phosphorylation | SESLGIPSLRVLAQK CCCCCCCHHHHHHHH | 27.21 | 24719451 | |
217 | Phosphorylation | WPELYLYSRADEVVL CCEEEEEECCCEEEH | 20.56 | 24719451 | |
244 | Phosphorylation | ARRVLARSVDFVSSA HHHHHHHHCCCHHHH | 22.04 | 26074081 | |
249 | Phosphorylation | ARSVDFVSSAHVSHL HHHCCCHHHHHHHHH | 23.08 | 26074081 | |
250 | Phosphorylation | RSVDFVSSAHVSHLR HHCCCHHHHHHHHHC | 19.66 | 26074081 | |
254 | Phosphorylation | FVSSAHVSHLRDYPT CHHHHHHHHHCCCCC | 13.62 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM53_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM53_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM53_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...