UniProt ID | TMLH_HUMAN | |
---|---|---|
UniProt AC | Q9NVH6 | |
Protein Name | Trimethyllysine dioxygenase, mitochondrial | |
Gene Name | TMLHE | |
Organism | Homo sapiens (Human). | |
Sequence Length | 421 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML). [PubMed: 11431483] | |
Protein Sequence | MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVLFIDNWRVLHGRECFTGYRQLCGCYLTRDDVLNTARLLGLQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Ubiquitination | SRLQDLLKGGVIYPA HHHHHHHCCCCCCCC | 62.00 | - | |
29 (in isoform 8) | Ubiquitination | - | 46.41 | - | |
84 | Ubiquitination | RDHCRSASCYNSKTH HHHHCCCCCCCCCCC | 20.55 | 21890473 | |
119 | Phosphorylation | DETTLFFTWPDGHVT CCCEEEEECCCCCEE | 28.84 | - | |
126 | Phosphorylation | TWPDGHVTKYDLNWL ECCCCCEEEEEHHHH | 20.43 | - | |
135 (in isoform 2) | Ubiquitination | - | 37.70 | 21890473 | |
135 (in isoform 1) | Ubiquitination | - | 37.70 | 21890473 | |
135 | Ubiquitination | YDLNWLVKNSYEGQK EEHHHHHHCCCCCCC | 37.70 | 21890473 | |
135 | Ubiquitination | YDLNWLVKNSYEGQK EEHHHHHHCCCCCCC | 37.70 | 21890473 | |
135 | Ubiquitination | YDLNWLVKNSYEGQK EEHHHHHHCCCCCCC | 37.70 | 22817900 | |
144 | Ubiquitination | SYEGQKQKVIQPRIL CCCCCCCEEECCEEE | 48.63 | 29967540 | |
146 (in isoform 8) | Ubiquitination | - | 6.34 | - | |
179 | Acetylation | ETNEGLKKFLQNFLL HCCHHHHHHHHHHHH | 57.24 | - | |
210 | Phosphorylation | EKLAERISLIRETIY HHHHHHHHHHHHHHH | 24.78 | 24825855 | |
236 | Ubiquitination | RGDTAYTKLALDRHT CCCCCHHHHHHCCCC | 21.06 | 19608861 | |
236 | Acetylation | RGDTAYTKLALDRHT CCCCCHHHHHHCCCC | 21.06 | 19608861 | |
247 (in isoform 8) | Ubiquitination | - | 12.83 | - | |
294 | Ubiquitination | EEFELLSKVPLKHEY HHHHHHHCCCCCCCC | 48.09 | 29967540 | |
395 | Phosphorylation | LHGRECFTGYRQLCG ECCCCCCCCHHHHHC | 44.99 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMLH_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMLH_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMLH_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMLH_HUMAN | TMLHE | physical | 11431483 |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-236, AND MASS SPECTROMETRY. |