dbPTM

TM40L_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TM40L_HUMAN
UniProt AC	Q969M1
Protein Name	Mitochondrial import receptor subunit TOM40B
Gene Name	TOMM40L
Organism	Homo sapiens (Human).
Sequence Length	308
Subcellular Localization	Mitochondrion outer membrane Multi-pass membrane protein.
Protein Description	Potential channel-forming protein implicated in import of protein precursors into mitochondria..
Protein Sequence	MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFHCGFSITVG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MGNTLGLAPMG ----CCCCCCCCCCC	19.24	20363803
12	Phosphorylation	LGLAPMGTLPRRSPR CCCCCCCCCCCCCCC	27.60	20363803
17	Phosphorylation	MGTLPRRSPRREEPL CCCCCCCCCCCCCCC	24.84	20068231
29	Phosphorylation	EPLPNPGSFDELHRL CCCCCCCCHHHHHHH	30.68	26471730
49	Ubiquitination	PAQMEGVKLVVNKVL HHHHCCHHHHHHHHH	46.55	29967540
122	Ubiquitination	LAERLRAKAVFQTQQ HHHHHHHHHHEEECC	38.35	32142685

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TM40L_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TM40L_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TM40L_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KFA_HUMAN	AFMID	physical	26186194

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TM40L_HUMAN

Related Literatures of Post-Translational Modification