UniProt ID | TM256_HUMAN | |
---|---|---|
UniProt AC | Q8N2U0 | |
Protein Name | Transmembrane protein 256 | |
Gene Name | TMEM256 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 113 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAGPAAAFRRLGALSGAAALGFASYGAHGAQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPSIQTLAPAGGTLLLLGWLALAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | FRRLGALSGAAALGF HHHHHHHHHHHHHCH | - | ||
25 | Phosphorylation | AALGFASYGAHGAQF HHHCHHHHCCCCCCC | - | ||
36 | Phosphorylation | GAQFPDAYGKELFDK CCCCCCHHHHHHHHH | - | ||
43 | Acetylation | YGKELFDKANKHHFL HHHHHHHHHCHHHHH | 25825284 | ||
43 | Ubiquitination | YGKELFDKANKHHFL HHHHHHHHHCHHHHH | 29967540 | ||
43 | 2-Hydroxyisobutyrylation | YGKELFDKANKHHFL HHHHHHHHHCHHHHH | - | ||
102 | Phosphorylation | TLAPAGGTLLLLGWL HCCCCCHHHHHHHHH | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM256_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM256_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM256_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
G6PI_HUMAN | GPI | physical | 22939629 | |
VDAC3_HUMAN | VDAC3 | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...