UniProt ID | TM107_HUMAN | |
---|---|---|
UniProt AC | Q6UX40 | |
Protein Name | Transmembrane protein 107 {ECO:0000312|HGNC:HGNC:28128} | |
Gene Name | TMEM107 {ECO:0000312|HGNC:HGNC:28128} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . Cell projection, cilium . Localizes at the transition zone, a region between the basal body and the ciliary axoneme. |
|
Protein Description | Plays a role in cilia formation and embryonic patterning. Requires for normal Sonic hedgehog (Shh) signaling in the neural tube and acts in combination with GLI2 and GLI3 to pattern ventral and intermediate neuronal cell types (By similarity). During ciliogenesis regulates the ciliary transition zone localization of some MKS complex proteins. [PubMed: 26518474] | |
Protein Sequence | MGRVSGLVPSRFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLKKKPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | N-linked_Glycosylation | LSGVSMFNSTQSLIS HHCHHCCCCCCCHHH | 35.19 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM107_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM107_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM107_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AT11C_HUMAN | ATP11C | physical | 28514442 | |
T179B_HUMAN | TMEM179B | physical | 28514442 | |
PCX3_HUMAN | PCNXL3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...