dbPTM

TM107_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TM107_HUMAN
UniProt AC	Q6UX40
Protein Name	Transmembrane protein 107 {ECO:0000312\|HGNC:HGNC:28128}
Gene Name	TMEM107 {ECO:0000312\|HGNC:HGNC:28128}
Organism	Homo sapiens (Human).
Sequence Length	140
Subcellular Localization	Membrane Multi-pass membrane protein . Cell projection, cilium . Localizes at the transition zone, a region between the basal body and the ciliary axoneme.
Protein Description	Plays a role in cilia formation and embryonic patterning. Requires for normal Sonic hedgehog (Shh) signaling in the neural tube and acts in combination with GLI2 and GLI3 to pattern ventral and intermediate neuronal cell types (By similarity). During ciliogenesis regulates the ciliary transition zone localization of some MKS complex proteins. [PubMed: 26518474]
Protein Sequence	MGRVSGLVPSRFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLKKKPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
79	N-linked_Glycosylation	LSGVSMFNSTQSLIS HHCHHCCCCCCCHHH	35.19	UniProtKB CARBOHYD

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TM107_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TM107_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TM107_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AT11C_HUMAN	ATP11C	physical	28514442
T179B_HUMAN	TMEM179B	physical	28514442
PCX3_HUMAN	PCNXL3	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TM107_HUMAN

Related Literatures of Post-Translational Modification