dbPTM

TIRR_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TIRR_CHICK
UniProt AC	Q9IAY5
Protein Name	Tudor-interacting repair regulator protein {ECO:0000250\|UniProtKB:Q9BRJ7}
Gene Name	NUDT16L1
Organism	Gallus gallus (Chicken).
Sequence Length	314
Subcellular Localization	Nucleus . Cytoplasm, cytoskeleton . Cell membrane Lipid-anchor Cytoplasmic side . Cell junction, focal adhesion . Colocalizes with SDC4 in ventral plasma membrane adhesion plaques.
Protein Description	Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin..
Protein Sequence	MGVMAAVGALPAGAGSLPPLPTLGVPGVPELKPLTRYEAMRLGPGWSHSCHAMLYAPNPGMLFGRIPLRYAVLMQMRFDGLLGFPGGFVDRRYWSLEDGLNRVLGLGLGCVRLTEADYLCSHLTDGPHRVVAHLYARQLTLEELHTIEISAVHSRDHGLEVMGMVRVPLYTQKDRMGGLPNFLANSFVGTAKFQLLFALKILNMVPEEKLAEAVAATQKPKKPAIDHAAVAAAKQANELAAAARAGNEYADSGENQAAAHAAAELAEQQAAGLESQAVLEHLAAVPGAEAVVAELHAQPGADAVLEQPVAEAME

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Myristoylation	------MGVMAAVGA ------CCCCCCCCC		10633082

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TIRR_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TIRR_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TIRR_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PAXI_CHICK	PXN	physical	11805099

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TIRR_CHICK

Related Literatures of Post-Translational Modification