TIR1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIR1_YEAST
• UniProt AC: P10863
• Protein Name: Cold shock-induced protein TIR1
• Gene Name: TIR1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 254
• Subcellular Localization: Secreted, cell wall. Membrane; Lipid-anchor, GPI-anchor. Covalently-linked GPI-modified cell wall protein (GPI-CWP).
• Protein Description: Component of the cell wall. Required for anaerobic growth..
• Protein Sequence: MAYTKIALFAAIAALASAQTQDQINELNVILNDVKSHLQEYISLASDSSSGFSLSSMPAGVLDIGMALASATDDSYTTLYSEVDFAGVSKMLTMVPWYSSRLEPALKSLNGDASSSAAPSSSAAPTSSAAPSSSAAPTSSAASSSSEAKSSSAAPSSSEAKSSSAAPSSSEAKSSSAAPSSSEAKSSSAAPSSTEAKITSAAPSSTGAKTSAISQITDGQIQATKAVSEQTENGAAKAFVGMGAGVVAAAAMLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
233	GPI-anchor	AVSEQTENGAAKAFV HHHHHCCCCCHHHHH	49.11	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIR1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIR1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIR1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MNN11_YEAST	MNN11	genetic	23891562
BCS1_YEAST	BCS1	genetic	27708008
NKP2_YEAST	NKP2	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.