UniProt ID | TIMP4_HUMAN | |
---|---|---|
UniProt AC | Q99727 | |
Protein Name | Metalloproteinase inhibitor 4 | |
Gene Name | TIMP4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 224 | |
Subcellular Localization | Secreted. | |
Protein Description | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.. | |
Protein Sequence | MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MPGSPRPAPSW ----CCCCCCCCHHH | 16.32 | - | |
10 | Phosphorylation | GSPRPAPSWVLLLRL CCCCCCHHHHHHHHH | 31.74 | - | |
76 | Ubiquitination | KMLRYEIKQIKMFKG HHHHHHHHHHHCCCC | 33.75 | 29967540 | |
86 | Methylation | KMFKGFEKVKDVQYI HCCCCCCCCCCEEEE | 52.93 | 23644510 | |
92 | Phosphorylation | EKVKDVQYIYTPFDS CCCCCEEEEECCCCC | 8.85 | 29759185 | |
114 | Nitration | EANSQKQYLLTGQVL EECCCCEEEEEEEEE | 15.66 | - | |
188 | Nitration | WLLERKLYGYQAQHY HHHHHHHHHHHCCEE | 19.47 | - | |
190 | Nitration | LERKLYGYQAQHYVC HHHHHHHHHCCEEEE | 6.26 | - | |
195 | Nitration | YGYQAQHYVCMKHVD HHHHCCEEEEEEECC | 5.35 | - | |
204 | Phosphorylation | CMKHVDGTCSWYRGH EEEECCCCCEECCCC | 10.02 | 26074081 | |
206 | Phosphorylation | KHVDGTCSWYRGHLP EECCCCCEECCCCCC | 27.29 | 26074081 | |
208 | Phosphorylation | VDGTCSWYRGHLPLR CCCCCEECCCCCCCC | 7.16 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIMP4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIMP4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIMP4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MMP2_HUMAN | MMP2 | physical | 9182583 | |
PCSK5_MOUSE | Pcsk5 | physical | 16135528 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...