| UniProt ID | TIMP4_HUMAN | |
|---|---|---|
| UniProt AC | Q99727 | |
| Protein Name | Metalloproteinase inhibitor 4 | |
| Gene Name | TIMP4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 224 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.. | |
| Protein Sequence | MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MPGSPRPAPSW ----CCCCCCCCHHH | 16.32 | - | |
| 10 | Phosphorylation | GSPRPAPSWVLLLRL CCCCCCHHHHHHHHH | 31.74 | - | |
| 76 | Ubiquitination | KMLRYEIKQIKMFKG HHHHHHHHHHHCCCC | 33.75 | 29967540 | |
| 86 | Methylation | KMFKGFEKVKDVQYI HCCCCCCCCCCEEEE | 52.93 | 23644510 | |
| 92 | Phosphorylation | EKVKDVQYIYTPFDS CCCCCEEEEECCCCC | 8.85 | 29759185 | |
| 114 | Nitration | EANSQKQYLLTGQVL EECCCCEEEEEEEEE | 15.66 | - | |
| 188 | Nitration | WLLERKLYGYQAQHY HHHHHHHHHHHCCEE | 19.47 | - | |
| 190 | Nitration | LERKLYGYQAQHYVC HHHHHHHHHCCEEEE | 6.26 | - | |
| 195 | Nitration | YGYQAQHYVCMKHVD HHHHCCEEEEEEECC | 5.35 | - | |
| 204 | Phosphorylation | CMKHVDGTCSWYRGH EEEECCCCCEECCCC | 10.02 | 26074081 | |
| 206 | Phosphorylation | KHVDGTCSWYRGHLP EECCCCCEECCCCCC | 27.29 | 26074081 | |
| 208 | Phosphorylation | VDGTCSWYRGHLPLR CCCCCEECCCCCCCC | 7.16 | 26074081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIMP4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIMP4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIMP4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MMP2_HUMAN | MMP2 | physical | 9182583 | |
| PCSK5_MOUSE | Pcsk5 | physical | 16135528 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
