dbPTM

TIFA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TIFA_MOUSE
UniProt AC	Q793I8
Protein Name	TRAF-interacting protein with FHA domain-containing protein A
Gene Name	Tifa
Organism	Mus musculus (Mouse).
Sequence Length	184
Subcellular Localization
Protein Description	Adapter protein which mediates the IRAK1 and TRAF6 interaction following IL-1 stimulation, resulting in the downstream activation of NF-kappa-B and AP-1 pathways. Induces the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism..
Protein Sequence	MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMDENEL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	STFEDADTEETVTCL CCCCCCCHHHEEEEE	37.12	-
174	Phosphorylation	SSYFTHRSSPSEMDE CCCCCCCCCHHHCCC	38.71	21743459
175	Phosphorylation	SYFTHRSSPSEMDEN CCCCCCCCHHHCCCC	32.19	25521595
177	Phosphorylation	FTHRSSPSEMDENEL CCCCCCHHHCCCCCC	47.72	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TIFA_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
9	T	Phosphorylation	-
Phosphorylated at Thr-9 following detection of ADP-D-glycero-beta-D-manno-heptose (ADP-Heptose) by ALPK1.
9	T	Phosphorylation	-
Phosphorylation at Thr-9 by ALPK1 leads to the formation of an intermolecular binding between the FHA domain and phosphorylated Thr-9, promoting TIFA oligomerization and TIFA-mediated NF-kappa-B activation.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TIFA_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TRAF2_MOUSE	Traf2	physical	11798190

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TIFA_MOUSE

Related Literatures of Post-Translational Modification