UniProt ID | TIF4A_ARATH | |
---|---|---|
UniProt AC | Q7XA73 | |
Protein Name | Protein TIFY 4A | |
Gene Name | TIFY4A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 313 | |
Subcellular Localization | Nucleus . | |
Protein Description | Regulates the arrest of dispersed meristematic cells during lamina development.. | |
Protein Sequence | MDVGVSPAKSILAKPLKLLTEEDISQLTREDCRKFLKDKGMRRPSWNKSQAIQQVLSLKALYEPGDDSGAGIFRKILVSQPVNPPRVTTTLIEPSNELEACGRVSYPEDNGACHRMDSPRSAEFSGGSGHFVSEKDGHKTTISPRSPAETSELVGQMTIFYSGKVNVYDGIPPEKARSIMHFAANPIDLPENGIFASSRMISKLISKEKMMELPQKGLEKANSSRDSGMEGQANRKVSLQRYREKRKDRKFSKAKKCPGVASSSLEMFLNCQPRMKAAYSQNLGCTGSPLHSQSPESQTKSPNLSVDLNSEGI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
57 | Phosphorylation | QAIQQVLSLKALYEP HHHHHHHCHHHHCCC | 29.03 | 24894044 | |
178 | Phosphorylation | IPPEKARSIMHFAAN CCHHHHHHHHHHHCC | 29.17 | 19880383 | |
197 | Phosphorylation | PENGIFASSRMISKL CCCCCCCCHHHHHHH | 14.02 | 19880383 | |
198 | Phosphorylation | ENGIFASSRMISKLI CCCCCCCHHHHHHHH | 23.57 | 19880383 | |
202 | Phosphorylation | FASSRMISKLISKEK CCCHHHHHHHHCHHH | 16.44 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIF4A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIF4A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIF4A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSAA_ARATH | psaA | physical | 23221595 | |
PSAB_ARATH | psaB | physical | 23221595 | |
PSAC_ARATH | psaC | physical | 23221595 | |
PSAD1_ARATH | PSAD-1 | physical | 23221595 | |
PSAE2_ARATH | PSAE-2 | physical | 23221595 | |
PSAF_ARATH | PSAF | physical | 23221595 | |
PSAG_ARATH | PSAG | physical | 23221595 | |
PSAH2_ARATH | PSAH2 | physical | 23221595 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...