UniProt ID | PSAC_ARATH | |
---|---|---|
UniProt AC | P62090 | |
Protein Name | Photosystem I iron-sulfur center {ECO:0000255|HAMAP-Rule:MF_01303} | |
Gene Name | psaC {ECO:0000255|HAMAP-Rule:MF_01303} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 81 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Peripheral membrane protein Stromal side . |
|
Protein Description | Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with PsaA/B/D and helps assemble the protein into the PSI complex. Required for binding of PsaD and PsaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn.. | |
Protein Sequence | MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Phosphorylation | RVYLWHETTRSMGLA EEEEEECCCCCCCCC | 18.02 | 25561503 | |
74 | Phosphorylation | VYLWHETTRSMGLAY EEEEECCCCCCCCCC | 20.12 | 29654922 | |
81 | Nitration | TRSMGLAY------- CCCCCCCC------- | 24.91 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSAC_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSAC_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSAC_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PSAC_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...