UniProt ID | TGFA_HUMAN | |
---|---|---|
UniProt AC | P01135 | |
Protein Name | Protransforming growth factor alpha | |
Gene Name | TGFA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 160 | |
Subcellular Localization |
Transforming growth factor alpha: Secreted, extracellular space. Protransforming growth factor alpha: Cell membrane Single-pass type I membrane protein. |
|
Protein Description | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.. | |
Protein Sequence | MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | N-linked_Glycosylation | AACQALENSTSPLSA HHHHHHHCCCCCCCC | 51.98 | UniProtKB CARBOHYD | |
153 | S-palmitoylation | LLKGRTACCHSETVV HHCCCCEECCCCCCC | 1.80 | 8910478 | |
154 | S-palmitoylation | LKGRTACCHSETVV- HCCCCEECCCCCCC- | 3.52 | 8910478 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TGFA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TGFA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TGFA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NKD2_HUMAN | NKD2 | physical | 18757723 | |
ERBB2_HUMAN | ERBB2 | physical | 25241761 | |
ADA17_HUMAN | ADAM17 | physical | 25241761 | |
DLG1_HUMAN | DLG1 | physical | 18930083 | |
ADA17_HUMAN | ADAM17 | physical | 18930083 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00017 | Esophageal cancer | |||||
H00018 | Gastric cancer | |||||
H00516 | Isolated orofacial clefts, including: Cleft lip with or without cleft palate; Cleft palate | |||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Palmitoylation | |
Reference | PubMed |
"Cysteines 153 and 154 of transmembrane transforming growth factor-alpha are palmitoylated and mediate cytoplasmic protein association."; Shum L., Turck C.W., Derynck R.; J. Biol. Chem. 271:28502-28508(1996). Cited for: PALMITOYLATION AT CYS-153 AND CYS-154. |